![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
![]() | Protein Hypothetical protein PA0269 [140973] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140974] (2 PDB entries) Uniprot Q9I6M1 2-144! Uniprot Q9I6M1 2-145 |
![]() | Domain d2ijca1: 2ijc A:2-144 [137465] |
PDB Entry: 2ijc (more details), 2.05 Å
SCOPe Domain Sequences for d2ijca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijca1 a.152.1.3 (A:2-144) Hypothetical protein PA0269 {Pseudomonas aeruginosa [TaxId: 287]} ttrlewakaspdayaamlglekalakaglerplielvylrtsqingcaycvnmhandark ageteqrlqalcvwqetpyftpreraalawteqlarlsqgalphglldelrehfddkeia eltlavsainawnrfgvgmgmqp
Timeline for d2ijca1: