Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [81866] (52 PDB entries) |
Domain d2ij7c_: 2ij7 C: [137459] automated match to d1n40a_ complexed with hem, tpf |
PDB Entry: 2ij7 (more details), 1.9 Å
SCOPe Domain Sequences for d2ij7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij7c_ a.104.1.1 (C:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} llevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmket aaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldnli tegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdrd ieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltta lisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgelv lvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallkk mpgvdlavpidqlvwrtrfqrriperlpvlw
Timeline for d2ij7c_: