![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [81866] (52 PDB entries) |
![]() | Domain d2ij7e_: 2ij7 E: [137461] automated match to d1n40a_ complexed with hem, tpf |
PDB Entry: 2ij7 (more details), 1.9 Å
SCOPe Domain Sequences for d2ij7e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij7e_ a.104.1.1 (E:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} llevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmket aaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldnli tegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdrd ieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltta lisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgelv lvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallkk mpgvdlavpidqlvwrtrfqrriperlpvlw
Timeline for d2ij7e_: