SCOPe 2.07: Domain d2ij0a1: 2ij0 A:4-93

Lineage for d2ij0a1 (2ij0 A:4-93)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)

8. Domain d2ij0a1: 2ij0 A:4-93 [137445]
   Other proteins in same PDB: d2ij0a2, d2ij0b2, d2ij0c1, d2ij0e_
   automated match to d2tssa1

Details for d2ij0a1

PDB Entry: 2ij0, 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d2ij0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ij0a1 b.40.2.2 (A:4-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
dnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvd
lntkrtkksqhtsegtyihfqisgvtntek

Timeline for d2ij0a1:

• d2ij0a1 first appeared in SCOP 1.73
  
• d2ij0a1 appears in SCOPe 2.06
  
• d2ij0a1 appears in the current release, SCOPe 2.08