![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries) |
![]() | Domain d2ij0b1: 2ij0 B:1-93 [137447] Other proteins in same PDB: d2ij0a2, d2ij0b2, d2ij0c1, d2ij0e_ automated match to d2tssa1 |
PDB Entry: 2ij0 (more details), 2.25 Å
SCOPe Domain Sequences for d2ij0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij0b1 b.40.2.2 (B:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge kvdlntkrtkksqhtsegtyihfqisgvtntek
Timeline for d2ij0b1:
![]() Domains from other chains: (mouse over for more information) d2ij0a1, d2ij0a2, d2ij0c1, d2ij0e_ |