Lineage for d2igoe1 (2igo E:43-354,E:553-619)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096802Protein Pyranose 2-oxidase [117439] (1 species)
  7. 2096803Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 2096818Domain d2igoe1: 2igo E:43-354,E:553-619 [137393]
    Other proteins in same PDB: d2igoa2, d2igob2, d2igoc2, d2igod2, d2igoe2, d2igof2, d2igog2, d2igoh2
    automatically matched to d1tzla1
    complexed with fad, shg; mutant

Details for d2igoe1

PDB Entry: 2igo (more details), 1.95 Å

PDB Description: crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose
PDB Compounds: (E:) Pyranose oxidase

SCOPe Domain Sequences for d2igoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igoe1 c.3.1.2 (E:43-354,E:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmstawtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklteeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
anppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

SCOPe Domain Coordinates for d2igoe1:

Click to download the PDB-style file with coordinates for d2igoe1.
(The format of our PDB-style files is described here.)

Timeline for d2igoe1: