SCOPe 2.08: Domain d2igob1: 2igo B:43-354,B:553-619

Lineage for d2igob1 (2igo B:43-354,B:553-619)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Pyranose 2-oxidase [117439] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries)
   Uniprot Q8J136 43-619

8. Domain d2igob1: 2igo B:43-354,B:553-619 [137387]
   Other proteins in same PDB: d2igoa2, d2igob2, d2igoc2, d2igod2, d2igoe2, d2igof2, d2igog2, d2igoh2
   automatically matched to d1tzla1
   complexed with fad, shg; mutant

Details for d2igob1

PDB Entry: 2igo, 1.95 Å

PDB Description: crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose

PDB Compounds: (B:) Pyranose oxidase

SCOPe Domain Sequences for d2igob1:

Sequence; same for both SEQRES and ATOM records:

>d2igob1 c.3.1.2 (B:43-354,B:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmstawtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklteeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
anppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

Timeline for d2igob1:

• d2igob1 first appeared in SCOP 1.73
  
• d2igob1 appears in SCOPe 2.07