SCOPe 2.07: Domain d2igng1: 2ign G:43-354,G:553-619

Lineage for d2igng1 (2ign G:43-354,G:553-619)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Pyranose 2-oxidase [117439] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries)
   Uniprot Q8J136 43-619

8. Domain d2igng1: 2ign G:43-354,G:553-619 [137381]
   Other proteins in same PDB: d2igna2, d2ignb2, d2ignc2, d2ignd2, d2igne2, d2ignf2, d2igng2, d2ignh2
   automatically matched to d1tzla1
   complexed with fad, mes; mutant

Details for d2igng1

PDB Entry: 2ign, 1.65 Å

PDB Description: crystal structure of recombinant pyranose 2-oxidase h167a mutant

PDB Compounds: (G:) Pyranose oxidase

SCOPe Domain Sequences for d2igng1:

Sequence; same for both SEQRES and ATOM records:

>d2igng1 c.3.1.2 (G:43-354,G:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmstawtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklteeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
anppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

Timeline for d2igng1:

• d2igng1 first appeared in SCOP 1.73
  
• d2igng1 appears in SCOPe 2.06
  
• d2igng1 appears in the current release, SCOPe 2.08