SCOPe 2.07: Domain d2ignd2: 2ign D:355-552

Lineage for d2ignd2 (2ign D:355-552)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Pyranose 2-oxidase [117843] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
   Uniprot Q8J136 43-619

8. Domain d2ignd2: 2ign D:355-552 [137376]
   Other proteins in same PDB: d2igna1, d2ignb1, d2ignc1, d2ignd1, d2igne1, d2ignf1, d2igng1, d2ignh1
   automatically matched to d1tzla2
   complexed with fad, mes; mutant

Details for d2ignd2

PDB Entry: 2ign, 1.65 Å

PDB Description: crystal structure of recombinant pyranose 2-oxidase h167a mutant

PDB Compounds: (D:) Pyranose oxidase

SCOPe Domain Sequences for d2ignd2:

Sequence; same for both SEQRES and ATOM records:

>d2ignd2 d.16.1.1 (D:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

Timeline for d2ignd2:

• d2ignd2 first appeared in SCOP 1.73
  
• d2ignd2 appears in SCOPe 2.06
  
• d2ignd2 appears in the current release, SCOPe 2.08