SCOP 1.73: Domain d2ic0a2: 2ic0 A:137-295

Lineage for d2ic0a2 (2ic0 A:137-295)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (15 PDB entries)

8. Domain d2ic0a2: 2ic0 A:137-295 [137232]
   automatically matched to d1r56c2
   complexed with ace, aza, na, xe

Details for d2ic0a2

PDB Entry: 2ic0, 1.78 Å

PDB Description: urate oxidase under 2.0 mpa pressure of xenon

PDB Compounds: (A:) Uricase

SCOP Domain Sequences for d2ic0a2:

Sequence; same for both SEQRES and ATOM records:

>d2ic0a2 d.96.1.4 (A:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

Timeline for d2ic0a2:

• d2ic0a2 is new in SCOP 1.73
  
• d2ic0a2 appears in SCOP 1.75
  
• d2ic0a2 appears in the current release, SCOPe 2.08