SCOP 1.73: Domain d2i9aa2: 2i9a A:50-132

Lineage for d2i9aa2 (2i9a A:50-132)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Urokinase-type plasminogen activator [57453] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries)

8. Domain d2i9aa2: 2i9a A:50-132 [137111]
   Other proteins in same PDB: d2i9aa1, d2i9ab1, d2i9ac1, d2i9ad1
   automatically matched to d1urk_2
   complexed with po4

Details for d2i9aa2

PDB Entry: 2i9a, 1.9 Å

PDB Description: crystal structure of the free aminoterminal fragment of urokinase type plasminogen activator (atf)

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2i9aa2:

Sequence; same for both SEQRES and ATOM records:

>d2i9aa2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d2i9aa2:

• d2i9aa2 is new in SCOP 1.73
  
• d2i9aa2 appears in SCOP 1.75
  
• d2i9aa2 appears in the current release, SCOPe 2.08