Lineage for d2i9ab2 (2i9a B:50-132)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748907Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 748908Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 748909Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 748988Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 748989Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries)
  8. 748991Domain d2i9ab2: 2i9a B:50-132 [137113]
    Other proteins in same PDB: d2i9aa1, d2i9ab1, d2i9ac1, d2i9ad1
    automatically matched to d1urk_2
    complexed with po4

Details for d2i9ab2

PDB Entry: 2i9a (more details), 1.9 Å

PDB Description: crystal structure of the free aminoterminal fragment of urokinase type plasminogen activator (atf)
PDB Compounds: (B:) urokinase-type plasminogen activator

SCOP Domain Sequences for d2i9ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ab2 g.14.1.1 (B:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOP Domain Coordinates for d2i9ab2:

Click to download the PDB-style file with coordinates for d2i9ab2.
(The format of our PDB-style files is described here.)

Timeline for d2i9ab2: