Class g: Small proteins [56992] (85 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (6 proteins) |
Protein Urokinase-type plasminogen activator [57453] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries) |
Domain d2i9ac2: 2i9a C:50-132 [137115] Other proteins in same PDB: d2i9aa1, d2i9ab1, d2i9ac1, d2i9ad1 automatically matched to d1urk_2 complexed with po4 |
PDB Entry: 2i9a (more details), 1.9 Å
SCOP Domain Sequences for d2i9ac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ac2 g.14.1.1 (C:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]} cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr rpwcyvqvglkplvqecmvhdca
Timeline for d2i9ac2: