Lineage for d2i5sx_ (2i5s X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890053Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1890067Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 1890075Domain d2i5sx_: 2i5s X: [137068]
    automated match to d1onc__
    protein/DNA complex

Details for d2i5sx_

PDB Entry: 2i5s (more details), 1.9 Å

PDB Description: crystal structure of onconase with bound nucleic acid
PDB Compounds: (X:) P-30 protein

SCOPe Domain Sequences for d2i5sx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5sx_ d.5.1.1 (X:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d2i5sx_:

Click to download the PDB-style file with coordinates for d2i5sx_.
(The format of our PDB-style files is described here.)

Timeline for d2i5sx_: