SCOPe 2.08: Domain d2i5sx_: 2i5s X:

Lineage for d2i5sx_ (2i5s X:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d2i5sx_: 2i5s X: [137068]
   automated match to d1onc__
   protein/DNA complex

Details for d2i5sx_

PDB Entry: 2i5s, 1.9 Å

PDB Description: crystal structure of onconase with bound nucleic acid

PDB Compounds: (X:) P-30 protein

SCOPe Domain Sequences for d2i5sx_:

Sequence; same for both SEQRES and ATOM records:

>d2i5sx_ d.5.1.1 (X:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d2i5sx_:

• d2i5sx_ first appeared in SCOP 1.73, called d2i5sx1
  
• d2i5sx_ appears in SCOPe 2.07