Lineage for d2i5sx1 (2i5s X:1-104)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715752Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 715753Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 715754Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 715755Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 715769Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (3 PDB entries)
  8. 715771Domain d2i5sx1: 2i5s X:1-104 [137068]
    automatically matched to d1onc__
    complexed with du

Details for d2i5sx1

PDB Entry: 2i5s (more details), 1.9 Å

PDB Description: crystal structure of onconase with bound nucleic acid
PDB Compounds: (X:) P-30 protein

SCOP Domain Sequences for d2i5sx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5sx1 d.5.1.1 (X:1-104) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOP Domain Coordinates for d2i5sx1:

Click to download the PDB-style file with coordinates for d2i5sx1.
(The format of our PDB-style files is described here.)

Timeline for d2i5sx1: