SCOPe 2.04: Domain d2i3ib_: 2i3i B:

Lineage for d2i3ib_ (2i3i B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
   Uniprot Q96CA5 78-159

8. Domain d2i3ib_: 2i3i B: [137026]
   automated match to d1oxnb_
   complexed with 618, btb, edo, li, zn

Details for d2i3ib_

PDB Entry: 2i3i, 2.3 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d2i3ib_:

Sequence; same for both SEQRES and ATOM records:

>d2i3ib_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlthsl

Timeline for d2i3ib_:

• d2i3ib_ first appeared in SCOP 1.73, called d2i3ib1
  
• d2i3ib_ was called d2i3ib1 in SCOPe 2.03
  
• d2i3ib_ appears in SCOPe 2.05
  
• d2i3ib_ appears in the current release, SCOPe 2.08