SCOP 1.73: Domain d2i3ib1: 2i3i B:78-167

Lineage for d2i3ib1 (2i3i B:78-167)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries)

8. Domain d2i3ib1: 2i3i B:78-167 [137026]
   automatically matched to d1tw6b_
   complexed with 618, btb, edo, li, zn; mutant

Details for d2i3ib1

PDB Entry: 2i3i, 2.3 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 7

SCOP Domain Sequences for d2i3ib1:

Sequence; same for both SEQRES and ATOM records:

>d2i3ib1 g.52.1.1 (B:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

Timeline for d2i3ib1:

• d2i3ib1 is new in SCOP 1.73
  
• d2i3ib1 appears in SCOP 1.75
  
• d2i3ib1 appears in the current release, SCOPe 2.08, called d2i3ib_