Lineage for d2hyfb2 (2hyf B:63-134)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092382Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1092383Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 1092384Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 1092442Protein Manganese transport regulator MntR [89086] (1 species)
  7. 1092443Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 1092462Domain d2hyfb2: 2hyf B:63-134 [136883]
    Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1
    automatically matched to d1on1a2
    complexed with epe, so4

Details for d2hyfb2

PDB Entry: 2hyf (more details), 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2hyfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyfb2 a.76.1.1 (B:63-134) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiq

SCOPe Domain Coordinates for d2hyfb2:

Click to download the PDB-style file with coordinates for d2hyfb2.
(The format of our PDB-style files is described here.)

Timeline for d2hyfb2: