Lineage for d2hxva1 (2hxv A:148-345)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904001Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
    Pfam PF01872
  6. 2904005Protein Riboflavin biosynthesis protein RibD [142702] (2 species)
  7. 2904023Species Thermotoga maritima [TaxId:2336] [142704] (1 PDB entry)
    Uniprot Q9X2E8 148-345
  8. 2904024Domain d2hxva1: 2hxv A:148-345 [136859]
    Other proteins in same PDB: d2hxva2, d2hxva3
    complexed with cl, gol, ndp, zn

Details for d2hxva1

PDB Entry: 2hxv (more details), 1.8 Å

PDB Description: crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (A:) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOPe Domain Sequences for d2hxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]}
pfvalkyastldgkiadhrgdskwitdklrfkvhemrniysavlvgagtvlkdnpqltcr
lkegrnpvrvildrkgvlsgkvfrvfeenarvivfteseeaeypphvekalsdcsvesil
rnlyerdidsvlveggskvfsefldhadvvfgfystkifgkgldvfsgylsdvsvppkfk
vvnvefsdseflvemrpc

SCOPe Domain Coordinates for d2hxva1:

Click to download the PDB-style file with coordinates for d2hxva1.
(The format of our PDB-style files is described here.)

Timeline for d2hxva1: