SCOPe 2.08: Domain d2ht0a_: 2ht0 A:

Lineage for d2ht0a_ (2ht0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein automated matches [190320] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187138] (1 PDB entry)

8. Domain d2ht0a_: 2ht0 A: [136728]
   Other proteins in same PDB: d2ht0b_
   automated match to d1ihfa_
   protein/DNA complex; complexed with cd

Details for d2ht0a_

PDB Entry: 2ht0, 2 Å

PDB Description: IHF bound to doubly nicked DNA

PDB Compounds: (A:) Integration host factor alpha-subunit

SCOPe Domain Sequences for d2ht0a_:

Sequence; same for both SEQRES and ATOM records:

>d2ht0a_ a.55.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

Timeline for d2ht0a_:

• d2ht0a_ first appeared in SCOP 1.73, called d2ht0a1
  
• d2ht0a_ appears in SCOPe 2.07