![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) |
![]() | Protein Integration host factor alpha subunit (IHFA) [88878] (1 species) heterodimer of two related subunits |
![]() | Species Escherichia coli [TaxId:562] [88879] (5 PDB entries) |
![]() | Domain d2ht0a1: 2ht0 A:2-97 [136728] Other proteins in same PDB: d2ht0b1 automatically matched to d1ihfa_ complexed with cd |
PDB Entry: 2ht0 (more details), 2 Å
SCOP Domain Sequences for d2ht0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ht0a1 a.55.1.1 (A:2-97) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp grnpktgedipitarrvvtfrpgqklksrvenaspk
Timeline for d2ht0a1: