Lineage for d2hs3a3 (2hs3 A:167-345)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216893Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2216894Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2216895Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)
  6. 2216922Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 2216923Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 2216926Domain d2hs3a3: 2hs3 A:167-345 [136714]
    Other proteins in same PDB: d2hs3a1, d2hs3a2
    automated match to d1vk3a3
    complexed with fgr, po4

Details for d2hs3a3

PDB Entry: 2hs3 (more details), 2.3 Å

PDB Description: T. maritima PurL complexed with FGAR
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs3a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

SCOPe Domain Coordinates for d2hs3a3:

Click to download the PDB-style file with coordinates for d2hs3a3.
(The format of our PDB-style files is described here.)

Timeline for d2hs3a3: