SCOP 1.75: Domain d2hrua2: 2hru A:346-507

Lineage for d2hrua2 (2hru A:346-507)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
   TM1246

8. Domain d2hrua2: 2hru A:346-507 [136700]
   Other proteins in same PDB: d2hrua3, d2hrua4
   automatically matched to d1vk3a2
   complexed with adp, mg; mutant

Details for d2hrua2

PDB Entry: 2hru, 2.8 Å

PDB Description: t. maritima purl complexed with adp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hrua2:

Sequence; same for both SEQRES and ATOM records:

>d2hrua2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
veytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvth
sradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalkn
acefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkv

Timeline for d2hrua2:

• d2hrua2 first appeared in SCOP 1.73
  
• d2hrua2 appears in SCOPe 2.01
  
• d2hrua2 appears in the current release, SCOPe 2.08