Lineage for d2hrua2 (2hru A:346-507)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727583Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 727584Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins)
  6. 727595Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 727596Species Thermotoga maritima [TaxId:2336] [103083] (6 PDB entries)
    TM1246
  8. 727608Domain d2hrua2: 2hru A:346-507 [136700]
    Other proteins in same PDB: d2hrua3, d2hrua4
    automatically matched to d1vk3a2
    complexed with adp, mg; mutant

Details for d2hrua2

PDB Entry: 2hru (more details), 2.8 Å

PDB Description: t. maritima purl complexed with adp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hrua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrua2 d.79.4.1 (A:346-507) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
veytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvth
sradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalkn
acefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkv

SCOP Domain Coordinates for d2hrua2:

Click to download the PDB-style file with coordinates for d2hrua2.
(The format of our PDB-style files is described here.)

Timeline for d2hrua2: