Lineage for d2hrua4 (2hru A:508-603)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873568Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 873569Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 873570Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 873585Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 873586Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 873598Domain d2hrua4: 2hru A:508-603 [136702]
    Other proteins in same PDB: d2hrua1, d2hrua2
    automatically matched to d1vk3a4
    complexed with adp, mg; mutant

Details for d2hrua4

PDB Entry: 2hru (more details), 2.8 Å

PDB Description: t. maritima purl complexed with adp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d2hrua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrua4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOP Domain Coordinates for d2hrua4:

Click to download the PDB-style file with coordinates for d2hrua4.
(The format of our PDB-style files is described here.)

Timeline for d2hrua4: