Lineage for d2hrua1 (2hru A:2-166)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658122Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1658149Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1658150Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries)
    TM1246
  8. 1658161Domain d2hrua1: 2hru A:2-166 [136699]
    Other proteins in same PDB: d2hrua3, d2hrua4
    automated match to d1vk3a1
    complexed with adp, mg

Details for d2hrua1

PDB Entry: 2hru (more details), 2.8 Å

PDB Description: t. maritima purl complexed with adp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrua1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOPe Domain Coordinates for d2hrua1:

Click to download the PDB-style file with coordinates for d2hrua1.
(The format of our PDB-style files is described here.)

Timeline for d2hrua1: