Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
Species Thermotoga maritima [TaxId:2336] [103083] (7 PDB entries) TM1246 |
Domain d2hrua1: 2hru A:2-166 [136699] Other proteins in same PDB: d2hrua3, d2hrua4 automated match to d1vk3a1 complexed with adp, mg |
PDB Entry: 2hru (more details), 2.8 Å
SCOPe Domain Sequences for d2hrua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrua1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima [TaxId: 2336]} klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd yysvafkiesanhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds
Timeline for d2hrua1: