SCOPe 2.08: Domain d2hrua4: 2hru A:508-603

Lineage for d2hrua4 (2hru A:508-603)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domain 4 [419053] (1 species)
   protein duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
7. Species Thermotoga maritima [TaxId:2336] [419544] (7 PDB entries)
   TM1246

8. Domain d2hrua4: 2hru A:508-603 [136702]
   Other proteins in same PDB: d2hrua1, d2hrua2, d2hrua3
   automated match to d1vk3a4
   complexed with adp, mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d2hrua4

PDB Entry: 2hru, 2.8 Å

PDB Description: t. maritima purl complexed with adp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrua4:

Sequence; same for both SEQRES and ATOM records:

>d2hrua4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domain 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

Timeline for d2hrua4:

• d2hrua4 first appeared in SCOP 1.73
  
• d2hrua4 appears in SCOPe 2.07