![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
![]() | Domain d2hrua4: 2hru A:508-603 [136702] Other proteins in same PDB: d2hrua1, d2hrua2, d2hrua3 automated match to d1vk3a4 complexed with adp, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2hru (more details), 2.8 Å
SCOPe Domain Sequences for d2hrua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrua4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domain 4 {Thermotoga maritima [TaxId: 2336]} akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki evklpevrpahqmvlvfsertpvvdvpvkeigtlsr
Timeline for d2hrua4: