Lineage for d2hrqc_ (2hrq C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507027Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2507362Protein automated matches [190065] (7 species)
    not a true protein
  7. 2507368Species Human (Homo sapiens) [TaxId:9606] [186857] (69 PDB entries)
  8. 2507404Domain d2hrqc_: 2hrq C: [136692]
    automated match to d1mx1a_
    complexed with gd7, nag, sia, so4, suc

Details for d2hrqc_

PDB Entry: 2hrq (more details), 2.7 Å

PDB Description: crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent soman (gd)
PDB Compounds: (C:) Liver carboxylesterase 1

SCOPe Domain Sequences for d2hrqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrqc_ c.69.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d2hrqc_:

Click to download the PDB-style file with coordinates for d2hrqc_.
(The format of our PDB-style files is described here.)

Timeline for d2hrqc_: