SCOPe 2.01: Domain d2hqxb1: 2hqx B:8-97

Lineage for d2hqxb1 (2hqx B:8-97)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (8 proteins)
   Pfam PF00567

6. Protein P100 co-activator, SND1 [141207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141208] (1 PDB entry)
   Uniprot Q7KZF4 705-794

8. Domain d2hqxb1: 2hqx B:8-97 [136676]
   automatically matched to 2HQX A:8-97

Details for d2hqxb1

PDB Entry: 2hqx, 1.42 Å

PDB Description: Crystal structure of human P100 tudor domain conserved region

PDB Compounds: (B:) p100 co-activator tudor domain

SCOPe Domain Sequences for d2hqxb1:

Sequence; same for both SEQRES and ATOM records:

>d2hqxb1 b.34.9.1 (B:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqat

Timeline for d2hqxb1:

• d2hqxb1 first appeared in SCOP 1.73
  
• d2hqxb1 appears in SCOP 1.75
  
• d2hqxb1 appears in SCOPe 2.02
  
• d2hqxb1 appears in the current release, SCOPe 2.08, called d2hqxb_