SCOPe 2.08: Domain d2hqxb_: 2hqx B:

Lineage for d2hqxb_ (2hqx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein P100 co-activator, SND1 [141207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries)
   Uniprot Q7KZF4 705-794

8. Domain d2hqxb_: 2hqx B: [136676]
   automated match to d2hqxa1
   has additional insertions and/or extensions that are not grouped together

Details for d2hqxb_

PDB Entry: 2hqx, 1.42 Å

PDB Description: Crystal structure of human P100 tudor domain conserved region

PDB Compounds: (B:) p100 co-activator tudor domain

SCOPe Domain Sequences for d2hqxb_:

Sequence; same for both SEQRES and ATOM records:

>d2hqxb_ b.34.9.1 (B:) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqat

Timeline for d2hqxb_:

• d2hqxb_ first appeared in SCOP 1.73, called d2hqxb1
  
• d2hqxb_ appears in SCOPe 2.07