![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
![]() | Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species) |
![]() | Species Pseudomonas sp. [TaxId:69011] [228600] (14 PDB entries) |
![]() | Domain d2hmma2: 2hmm A:155-446 [136595] Other proteins in same PDB: d2hmma1, d2hmmb_ automated match to d1o7na2 complexed with an3, edo, fe, fes, so4 |
PDB Entry: 2hmm (more details), 1.6 Å
SCOPe Domain Sequences for d2hmma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmma2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 69011]} eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt
Timeline for d2hmma2: