SCOP 1.73: Domain d2hmma2: 2hmm A:155-446

Lineage for d2hmma2 (2hmm A:155-446)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)

7. Species Pseudomonas putida [TaxId:303] [55971] (16 PDB entries)

8. Domain d2hmma2: 2hmm A:155-446 [136595]
   Other proteins in same PDB: d2hmma1, d2hmmb1
   automatically matched to d1o7ga2
   complexed with an3, edo, fe, fes, so4; mutant

Details for d2hmma2

PDB Entry: 2hmm, 1.6 Å

PDB Description: crystal structure of naphthalene 1,2-dioxygenase bound to anthracene

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOP Domain Sequences for d2hmma2:

Sequence; same for both SEQRES and ATOM records:

>d2hmma2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

Timeline for d2hmma2:

• d2hmma2 is new in SCOP 1.73
  
• d2hmma2 appears in SCOP 1.75
  
• d2hmma2 appears in the current release, SCOPe 2.08