PDB entry 2hmm

View 2hmm on RCSB PDB site
Description: Crystal Structure of Naphthalene 1,2-Dioxygenase Bound to Anthracene
Class: Oxioreductase
Keywords: Oxioreductase, Protien, Rieske Oxygenase
Deposited on 2006-07-11, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase alpha subunit
    Species: Pseudomonas sp. [TaxId:306]
    Gene: doxB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hmma1, d2hmma2
  • Chain 'B':
    Compound: Naphthalene 1,2-dioxygenase beta subunit
    Species: Pseudomonas sp. [TaxId:306]
    Gene: doxD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hmmb_
  • Heterogens: FE, SO4, FES, AN3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hmmA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmmA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hmmB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmmB (B:)
    iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
    qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
    vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
    rilqthnlmvfl