Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
Protein Aspartokinase [142724] (3 species) |
Species Methanococcus jannaschii [TaxId:2190] [142726] (1 PDB entry) Uniprot Q57991 2-303 |
Domain d2hmfb1: 2hmf B:2-303 [136576] Other proteins in same PDB: d2hmfa2, d2hmfa3, d2hmfb2, d2hmfb3, d2hmfc2, d2hmfc3, d2hmfd2, d2hmfd3 automated match to d2hmfa1 complexed with adp, asp, mg |
PDB Entry: 2hmf (more details), 2.7 Å
SCOPe Domain Sequences for d2hmfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmfb1 c.73.1.3 (B:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} ttvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrd iakvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpks rdyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpl lkegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdpr lvptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitnd me
Timeline for d2hmfb1: