![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
![]() | Protein Aspartokinase [143391] (3 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry) Uniprot Q57991 304-403! Uniprot Q57991 404-470 |
![]() | Domain d2hmfc3: 2hmf C:304-403 [136581] Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1 automated match to d2hmfa3 complexed with adp, asp, mg |
PDB Entry: 2hmf (more details), 2.7 Å
SCOPe Domain Sequences for d2hmfc3:
Sequence, based on SEQRES records: (download)
>d2hmfc3 d.58.18.10 (C:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl vvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkd
>d2hmfc3 d.58.18.10 (C:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl vvseedvdkalkalkrefgdflnnnlirdvsvdkd
Timeline for d2hmfc3: