Lineage for d2hmfd2 (2hmf D:404-470)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. Protein Aspartokinase [143391] (3 species)
  7. Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry)
    Uniprot Q57991 304-403! Uniprot Q57991 404-470
  8. Domain d2hmfd2: 2hmf D:404-470 [136583]
    Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1
    automated match to d2hmfa2
    complexed with adp, asp, mg

Details for d2hmfd2

PDB Entry: 2hmf (more details), 2.7 Å

PDB Description: structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
PDB Compounds: (D:) Probable aspartokinase

SCOPe Domain Sequences for d2hmfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmfd2 d.58.18.10 (D:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfiek

SCOPe Domain Coordinates for d2hmfd2 are not available.

Timeline for d2hmfd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmfd1, d2hmfd3
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmfa1, d2hmfa2, d2hmfa3, d2hmfb1, d2hmfb2, d2hmfb3, d2hmfc1, d2hmfc2, d2hmfc3