| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
| Protein Aspartokinase [143391] (3 species) |
| Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry) Uniprot Q57991 304-403! Uniprot Q57991 404-470 |
| Domain d2hmfd2: 2hmf D:404-470 [136583] Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1 automated match to d2hmfa2 complexed with adp, asp, mg |
PDB Entry: 2hmf (more details), 2.7 Å
SCOPe Domain Sequences for d2hmfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmfd2 d.58.18.10 (D:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfiek
Timeline for d2hmfd2: