Lineage for d2hhsa1 (2hhs A:298-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886679Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2886680Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (43 PDB entries)
    Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 2886692Domain d2hhsa1: 2hhs A:298-468 [136508]
    Other proteins in same PDB: d2hhsa2
    automatically matched to d1l3sa1
    protein/DNA complex; complexed with mg, so4

Details for d2hhsa1

PDB Entry: 2hhs (more details), 1.8 Å

PDB Description: o6-methyl:c pair in the polymerase-10 basepair position
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhsa1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d2hhsa1:

Click to download the PDB-style file with coordinates for d2hhsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hhsa1: