Lineage for d2hgrv1 (2hgr V:2-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942145Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2942146Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2942147Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2942148Protein Ribosomal protein S19 [54572] (2 species)
  7. 2942176Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2942209Domain d2hgrv1: 2hgr V:2-81 [136459]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrw1, d2hgrx1
    protein/RNA complex
    protein/RNA complex

Details for d2hgrv1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (V:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2hgrv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrv1 d.28.1.1 (V:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2hgrv1:

Click to download the PDB-style file with coordinates for d2hgrv1.
(The format of our PDB-style files is described here.)

Timeline for d2hgrv1: