Lineage for d2hgrq1 (2hgr Q:2-61)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587071Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 2587072Protein Ribosomal protein S14 [57753] (2 species)
  7. 2587098Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 2587138Domain d2hgrq1: 2hgr Q:2-61 [136454]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1
    protein/RNA complex
    protein/RNA complex

Details for d2hgrq1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2hgrq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrq1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2hgrq1:

Click to download the PDB-style file with coordinates for d2hgrq1.
(The format of our PDB-style files is described here.)

Timeline for d2hgrq1: