SCOPe 2.08: Domain d2hgrh1: 2hgr H:74-154

Lineage for d2hgrh1 (2hgr H:74-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2hgrh1: 2hgr H:74-154 [136445]
   Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1
   protein/RNA complex
   protein/RNA complex

Details for d2hgrh1

PDB Entry: 2hgr, 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.

PDB Compounds: (H:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2hgrh1:

Sequence; same for both SEQRES and ATOM records:

>d2hgrh1 d.14.1.1 (H:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2hgrh1:

• d2hgrh1 first appeared in SCOP 1.73
  
• d2hgrh1 appears in SCOPe 2.07