| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Actin [53073] (6 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53074] (5 PDB entries) |
| Domain d2hf3a2: 2hf3 A:147-375 [136374] automatically matched to d1hlua2 complexed with adp, ca |
PDB Entry: 2hf3 (more details), 1.8 Å
SCOPe Domain Sequences for d2hf3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hf3a2 c.55.1.1 (A:147-375) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer
eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d2hf3a2: