![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (13 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries) |
![]() | Domain d2hf3a2: 2hf3 A:147-375 [136374] automated match to d1d4xa2 complexed with adp, ca |
PDB Entry: 2hf3 (more details), 1.8 Å
SCOPe Domain Sequences for d2hf3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hf3a2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d2hf3a2: