Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.1: HD domain [101340] (14 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein Hypothetical protein aq_1910 [140765] (1 species) elaborated with additional structures in C-terminal extension |
Species Aquifex aeolicus [TaxId:63363] [140766] (1 PDB entry) Uniprot O67745 1-369 |
Domain d2heka1: 2hek A:1-369 [136354] Other proteins in same PDB: d2hekb_ complexed with br, cl, gdp, gol, po4, zn |
PDB Entry: 2hek (more details), 2 Å
SCOPe Domain Sequences for d2heka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql wekarselk
Timeline for d2heka1: