Lineage for d2heka1 (2hek A:1-369)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014852Protein Hypothetical protein aq_1910 [140765] (1 species)
    elaborated with additional structures in C-terminal extension
  7. 2014853Species Aquifex aeolicus [TaxId:63363] [140766] (1 PDB entry)
    Uniprot O67745 1-369
  8. 2014854Domain d2heka1: 2hek A:1-369 [136354]
    Other proteins in same PDB: d2hekb_
    complexed with br, cl, gdp, gol, po4, zn

Details for d2heka1

PDB Entry: 2hek (more details), 2 Å

PDB Description: crystal structure of o67745, a hypothetical protein from aquifex aeolicus at 2.0 a resolution.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2heka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]}
mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh
itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye
ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff
dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl
isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke
rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql
wekarselk

SCOPe Domain Coordinates for d2heka1:

Click to download the PDB-style file with coordinates for d2heka1.
(The format of our PDB-style files is described here.)

Timeline for d2heka1: