SCOPe 2.08: Domain d2hd1a_: 2hd1 A:

Lineage for d2hd1a_ (2hd1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d2hd1a_: 2hd1 A: [136338]
   automated match to d1tbma_
   complexed with ibm, mg, zn

Details for d2hd1a_

PDB Entry: 2hd1, 2.23 Å

PDB Description: Crystal structure of PDE9 in complex with IBMX

PDB Compounds: (A:) Phosphodiesterase 9A

SCOPe Domain Sequences for d2hd1a_:

Sequence; same for both SEQRES and ATOM records:

>d2hd1a_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

Timeline for d2hd1a_:

• d2hd1a_ first appeared in SCOP 1.73, called d2hd1a1
  
• d2hd1a_ appears in SCOPe 2.07