![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein CC3309 [143177] (1 species) |
![]() | Species Caulobacter crescentus [TaxId:155892] [143178] (1 PDB entry) Uniprot Q9A395 12-153 |
![]() | Domain d2hboa1: 2hbo A:12-153 [136319] complexed with edo, pe4 |
PDB Entry: 2hbo (more details), 1.85 Å
SCOPe Domain Sequences for d2hboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} aipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgnchggmlmsfadm awgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlftvrgriwagertl itgtgvfkalsarkprpgelay
Timeline for d2hboa1: