PDB entry 2hbo

View 2hbo on RCSB PDB site
Description: Crystal structure of a thioesterase superfamily protein (cc_3309) from caulobacter vibrioides at 1.85 A resolution
Class: hydrolase
Keywords: Thioesterase/thiol ester dehydrase-isomerase fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2006-06-14, released 2006-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein (np_422103.1)
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: np_422103.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A395
      • modified residue (64)
      • modified residue (66)
      • modified residue (71)
      • modified residue (91)
      • modified residue (116)
    Domains in SCOPe 2.07: d2hboa1
  • Heterogens: PE4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hboA (A:)
    gmsddltdaqtaaipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgn
    chggmlmsfadmawgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlft
    vrgriwagertlitgtgvfkalsarkprpgelaykeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hboA (A:)
    aipegfsqlnwsrgfgrqigplfehregpgqarlafrveehhtnglgnchggmlmsfadm
    awgriislqksyswvtvrlmcdflsgaklgdwvegegeliseedmlftvrgriwagertl
    itgtgvfkalsarkprpgelay