Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) |
Family a.60.8.4: EXOSC10 HRDC domain-like [140646] (2 proteins) |
Protein Exosome complex exonuclease RRP6 domain [140647] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140648] (4 PDB entries) Uniprot Q12149 421-516 |
Domain d2hbka1: 2hbk A:421-516 [136313] Other proteins in same PDB: d2hbka2 automatically matched to 2HBJ A:421-516 protein/RNA complex; complexed with mn |
PDB Entry: 2hbk (more details), 2.25 Å
SCOPe Domain Sequences for d2hbka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kespwkilmyqynipperevlvrelyqwrdliarrddesprfvmpnqllaalvaytptdv igvvsltngvtehvrqnakllanlirdalrnikntn
Timeline for d2hbka1: